Technip wins PMC contract for the Basra Refinery Upgrading project

abarrelfullabarrelfull wrote on 29 Apr 2015 14:57
Tags: engineering iraq m-east refinery technip

Latest News

{"module":"feed\/FeedModule","params":{"src":"http:\/\/killajoules.wikidot.com\/feed\/pages\/pagename\/blog%3A_start\/category\/blog\/limit\/10\/t\/My+Blog","limit":"3","module_body":"* %%linked_title%%"}}
  • Want a weekly review of refining news?

Technip, in partnership with UNICO, a Japanese engineering consultant, was awarded a Project Management Consultancy (PMC) contract on a reimbursable basis, for the upgrading of the Basra refinery. This contract, awarded by South Refineries Company (SRC) – Ministry of Oil, covers the engineering, procurement, construction, commissioning, start-up and warranty management phase of the refinery upgrading project(1), located in Basra, Iraq.

The project will aim at increasing the gasoline production capacity through the installation of a new fluid catalytic cracking unit and associated units like visbreaker, hydrotreating, hydrogen plant, etc. This development is part of the Iraqi Government’s long term plan to meet increasing future demand for hydrocarbon products.

This award follows the PMC contract attributed to Technip in June 2013 for the Karbala refinery. It will be executed by Technip’s engineering center in Milton Keynes, United Kingdom, and supported by Technip PMC teams.

Technip PMC gathers all the know-how and expertise acquired by the Group over the years in executing challenging projects in the world. This new award continues to reinforce our position in PMC in the Middle East.

Nicoletta Giadrossi, President of Technip’s Region A(2), commented: “We are delighted to help SRC and the Iraqi’s Ministry of Oil achieve their goals and business objectives, while meeting safety, cost, schedule and quality targets".

Riccardo Moizo, Senior Vice President for Technip PMC, stated: “We are honoured to have been awarded this important project by SRC. This new award continues to reinforce Technip’s positioning on PMC activities. We are looking forward to assisting SRC in the development of this complex project.”

(1)The project has been funded by the Japan International Cooperation Agency (JICA).
(2)Region A is one of Technip’s regions comprising Western Europe, Africa and India.

Related News

{"module":"feed\/FeedModule","params":{"src":"http:\/\/killajoules.wikidot.com\/feed\/pages\/pagename\/blog%3A_start\/tag\/refinery\/category\/blog\/limit\/10\/t\/My+Blog","limit":"3","module_body":"* %%linked_title%%"}}

Looking for information on the Refining sector?

engineeringiraqm-eastrefinerytechnip
Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License